BFM 89.9

HIGHLIGHTS 
Podcast  >  Enterprise  >  Enterprise Explores  >  What's Next After The End of Cookies?

What's Next After The End of Cookies?

Weldon Fung, Area Director for Southeast Asia, Meltwater

04-Dec-23 12:00

What's Next After The End of Cookies?

For those of us Internet users, we would be familiar with the word “cookies”. They are used to remember your preferences, login information, and other browsing information, as well as to track your activity on the website and to personalise your experience.

Three years ago, Google announced that it would eliminate third-party cookies from Chrome by 2022, and later postponed its deadline until 2024.

In the ever-evolving landscape of digital marketing, the impending end of cookies marks a significant turning point. Once the bedrock of online tracking and personalised advertising, cookies are facing obsolescence due to growing privacy concerns and tightening regulations.

From the strategies businesses will adopt to navigate this new terrain to the varied impacts on marketers, advertisers, publishers, and consumers, the transition prompts a reevaluation of fundamental practices.

Today, we delve into the challenges and opportunities arising in a cookieless future.

Produced by: Carol Wong

Presented by: Richard Bradbury


This and more than 60,000 other podcasts in your hand. Download the all new BFM mobile app.

Categories:  marketstechnologymanaging

Tags:  personal data profilingCEGcookiesprivacyadvertisingmarketingdigital marketing





Play / Pause

Listen now : BFM 89.9 -- The Business Station

Today’s Shows



6:00 AM

The 6AM Stretch

Thought-provoking discussions on ideas, people and events shaping our lives.

7:00 AM

World Market Watch

Joe Quinlan, Chief Market Strategist, US Trust-BOA Private Wealth Management tells us where international markets are heading.

7:15 AM

Morning Brief

We recap global and local headlines from today's papers and portals.

7:30 AM

Morning Brief

Dan Ives, Managing Director, Wedbush Securities discusses his top buys in the tech sector

7:45 AM

Morning Brief

Dr. Azmi Hassan, Senior Fellow at the Nusantara Academy for Strategic Research, weighs in on Malaysia’s political scene, including Khairy Jamaluddin’s potential return to UMNO.

8:00 AM

The Breakfast Grille

Shyam Priah Marimuthu of Yellow House KL, along with Dr Nur Fareza Mustapha of Khazanah Research Institute, sheds light on the realities of homelessness in Malaysia.

8:30 AM

Morning Brief

Dr. Ng Choy Peng, Universiti Pertahanan Nasional Malaysia discusses how roads will be affected during the upcoming monsoon season.

8:45 AM

Morning Brief

Adrian Pereira, Executive Director, North-South Initiative discusses how the recent court ruling and US-Malaysia trade labour provision can reshape labour practices.

9:00 AM

Opening Bell

(REPEAT) Joe Quinlan, Chief Market Strategist, US Trust-BOA Private Wealth Management tells us where international markets are heading.

9:15 AM

Opening Bell

(REPEAT) We take a look at the FBM KLCI as well as regional capital markets.

9:35 AM

People, Planet, Profit

Redza Abdul Rahman of BIMB Securities discusses their report "The Price of Every Drop" on water management challenges in Malaysia.

10:05 AM

Open For Business

Kristy Ting, Founder, Side Gig Accelerator

11:00 AM

Marketing Mojo

Dulya Wijeratne, Key Accounts Lead, Cult Creative

12:00 PM

Enterprise Explores

Matt Armitage, Founder, Kulturpop

1:00 PM

The Breakfast Grille Repeat

Our flagship show, we feature both game-changers and groundbreakers in the hot seat.

2:05 PM

Discovery Hour

An eclectic selection of BBC shows, curated with variety in mind.

3:05 PM

Beyond the Ballot Box

We speak to Graeme Ramshaw and Ooi Kok Hin, from the Westminster Foundation for Democracy (WFD) about the cost of politics in Malaysia and the barriers of entry for women and PWDs.

4:05 PM

Health & Living

Are You Eating Enough Protein?: With high-protein snacks and drinks often marketed at us, are we not consuming enough protein in our diets? A nutritionist weighs in.

5:00 PM

Top 5 at 5

6:00 PM

Talkback Tuesday

Has automated services made life better? And do you think we've lost human connection as a result? Does that matter to you?

8:00 PM

BBC World Service